(£) GBP (Default)
  • ($) USD
  • (€) EUR
  • ($) AUD
  • ($) CAD
  • ($) NZD

LL-37 (Cap-18) Pre-Mixed Pen 5mg

As with other cathelicidins, LL-37 Cap-18 pre-mixed pen contains antimicrobial, antibacterial, antiviral, and antifungal properties and has been demonstrated to alleviate inflammation. Additionally, research indicates its impact against some malignancies promotes blood vessel formation in particular situations.

LL-37 Cap 18 5mg Pre-mixed Pen kit contains: 1 x Cartridge (premixed with Bacteriostatic Water), 1 x Cartridge Pen with 3 Pen Needle Tips, plus a Pen Carry Case.

LL-37 Cap 18 5mg Single Pre-mixed Cartridges: 1, 2 or 3 x Cartridge (premixed with Bacteriostatic Water) plus 3 Pen Needle Tips. (Single mixed cartridges do not contain the pen or case).

Get a 10% discount on 3 cartridge pack.

£40.37£109.00

SKU PG-LL-37-Pen Categories , ,

LL-37 cap-18 5mg Pre-Mixed Pen – Pharmagrade store Monaco

LL-37 cap-18 pre-mixed pen is an antibacterial peptide used to treat bacterial infections. Research has shown it is a member of the catatonic family of antimicrobial peptides found in humans.
LL-37 is a pharmaceutical peptide used to treat bacterial infections. Although its mechanism of function is derived from the innate LL-37, it has the potential to fight against both Gram-negative and Gram-positive bacteria. Research has suggested that it is one of the best antibacterial medications.

LL-37 has the potential to fight against bacteria, viruses, and fungi; including yeast infections. LL-37 cap-18 pre-mixed pen has also been shown to stop the viral function of the herpes simplex virus. Also, scientific investigations have uncovered it reduces viral replication in the vaccinia (smallpox) virus.

This peptide can also function as a chemo-attractant for immune cells, large amounts of innate LL-37 are found in infection sites because they attract the white blood cells to the infection sites.
Furthermore, LL-37 studies have demonstrated it could bind and neutralize lipopolysaccharides; this is beneficial because of LPS from the outermost membrane of Gram-negative bacteria.

LL-37 cap-18 pre-mixed pen could bind and neutralize the LPS on top of the gram-negative bacteria, the bacteria will not be protected. In turn, this will lead to the elimination of the bacteria.

LL-37 is also helpful in wound healing. Higher levels of LL-37 cap-18 Peptide are usually found in a wound, which often reduces after wound closure; scientists believe this shows that it helps in wound healing.
Also, higher amounts of LL-37 are found on the reforming epithelium of the wound, which means it also helps form the epithelium back.

Benefits of LL-37 cap-18 5mg Pre-mixed Pen:

Research has revealed the following benefits:

  • Ability to fight bacteria, viruses & fungi. Including yeast infections and herpes simplex virus.
  • Antimicrobial Functions
  • Acts as a chemo-attractant
  • Binding and neutralizing LPS
  • Re-epithelialization and wound closure

Amino Acid Sequence: LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES

Molecular Formula: C205H340N60O53

References:

https://pubmed.ncbi.nlm.nih.gov/16493063/

https://journals.aai.org/jimmunol/article/176/5/3044/73223/An-Antimicrobial-Cathelicidin-Peptide-Human-CAP18

Benefits of Pharma Grade Store Pre-mixed Peptide Pens

Pre-mixed pen kits include a cartridge, have a dosage dial, and single-use needle tips inside the case. As a result, pens are easier, more accurate, and more convenient than a vial and syringe. Single cartridges can be used to top up your kit.

Other benefits include:

  • Usability, especially for those new to research peptides.
  • The pens are portable and convenient.
  • The ability to set doses precisely using a dial.
  • Reduces the stress of mixing correctly
  • Because they are pre-mixed, they save time.
  • There are various accessories to facilitate storage and use.

 

ALL PRODUCT INFORMATION AND ARTICLES ON THIS SITE ARE FOR EDUCATIONAL PURPOSES ONLY

DISCLAIMER: All products sold by PharmaGrade.Store are for research and laboratory use only. These products are not designed for use or consumption by humans or animals. They are not to be classified as a drug, food, cosmetic, or medicinal product and must not be mislabelled or used as such. By purchasing from our Website the buyer accepts and acknowledges the risks involved with handling of these products. All articles and product information provided on this Website are for informational and educational purposes only. Handling and use of these products should be restricted to suitably qualified professionals.

Additional information

size

Pen Kit with 1 pre-mixed cartridge, 1 single mixed cartridge, 2 pre-mixed cartridges, 3 pre-mixed cartridges

Pen instructions

All pre-mixed cartridges are mixed with 2ml bacteriostatic water, pens will release approximately 0.5ml per 60 dials on the pen (one full pen)

To achieve the number of micrograms (mcg) that 1 dial on the pen will release you will need to simply divide the amount of product:

2mg = 2000mcg

5mg = 5000mcg

by the full amount of pen dials (which will always be 240)

E.g., 5000mcg divided by 240 = 20.83, therefore 1 dial on the pen for all 5mg products will release approximately 20.83mcg.

Certificates

LL-37_Pharmagrade HPLC Certificate

You may also like…